PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06882.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 475aa    MW: 52240.8 Da    PI: 8.5328
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06882.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.6e-16170218148
                                   TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+W++eEd  l+++++++G+g +W + ++++g++R++k+c++rw++yl
  Zmw_sc06882.1.g00030.1.am.mk 170 KGPWSPEEDAMLKNYIEEHGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 218
                                   79*********************************************97 PP

2Myb_DNA-binding36.89e-12225267246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   g +T+eEd  +  +    G++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc06882.1.g00030.1.am.mk 225 GDFTPEEDSVICSLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 267
                                   789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.796165218IPR017930Myb domain
SuperFamilySSF466891.88E-26168265IPR009057Homeodomain-like
SMARTSM007174.0E-13169220IPR001005SANT/Myb domain
PfamPF002494.0E-15170218IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-24171225IPR009057Homeodomain-like
CDDcd001675.20E-10172218No hitNo description
PROSITE profilePS5129421.102219273IPR017930Myb domain
SMARTSM007171.3E-10223271IPR001005SANT/Myb domain
PfamPF002494.8E-10225267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-22226273IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MGFGQVSLAS KPAGVPQRAS QARFVVQGSE THGPPGIRVL DLGTQYSAAA DCGRLGLVAI  60
DRSLPPLVRG GTRLAEYNCC RSTSFGFNGD RWCPISVVLP MTHCPSSSSS IVRGHPTPCL  120
PNQTHHHSTA QSRLPEKRPP RRRERREKKR KTKKTKMGRA PCCDKATVKK GPWSPEEDAM  180
LKNYIEEHGT GGNWIALPHK IGLKRCGKSC RLRWLNYLRP NIKHGDFTPE EDSVICSLYI  240
SIGSRWSIIA AQLPGRTDND VKNYWNTKLK KRLLGQRKDR PEAHRPSAAV VANETAAEMN  300
DGERALSASA MERIQLCMQL QELQNPLGAA IQTPALTTWP ASCRAAIQSN NSFNSNNSAG  360
SSVTVAEPGQ GSSVNDHHLN ARLVESAAMD GLASPSSAEN SNVISIEAEL QELLYGEADQ  420
QLRAGAIDDG MQQQQQQQQG DMDWWSYDQS KPVNCWDFTP EPNAVFQDYA SVYDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-221702737108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144150RREKKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973097.11e-165PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL21e-84MYB36_ARATH; Transcription factor MYB36
TrEMBLK3YMV21e-165K3YMV2_SETIT; Uncharacterized protein
STRINGSi015585m1e-165(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412